![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
![]() | Protein Hypothetical protein SSO2295 [143156] (1 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [143157] (1 PDB entry) Uniprot Q97WD2 1-134 |
![]() | Domain d2gf6a1: 2gf6 A:1-134 [135077] Other proteins in same PDB: d2gf6b_, d2gf6c_, d2gf6d_ complexed with ca, coa |
PDB Entry: 2gf6 (more details), 1.91 Å
SCOPe Domain Sequences for d2gf6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Sulfolobus solfataricus [TaxId: 2287]} menieyvfedvvriydtdaqgiahyaayyrfftntiekfikekvgipypivnenlwfvia eshaiyhrpvklgdkltvllnpkilsnktikfefkvlkdgelttegyviqiainpkiwks tempkeimdklsik
Timeline for d2gf6a1: