SCOPe 2.05: Domain d2gf5a2: 2gf5 A:2-83

Lineage for d2gf5a2 (2gf5 A:2-83)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.4: DEATH effector domain, DED [81388] (2 proteins)

6. Protein FADD (Mort1) [81387] (1 species)
   contains two domains of this superfamily: DED and DD, in this order

7. Species Human (Homo sapiens) [TaxId:9606] [81386] (3 PDB entries)

8. Domain d2gf5a2: 2gf5 A:2-83 [135076]
   Other proteins in same PDB: d2gf5a1
   automatically matched to d1a1w__

Details for d2gf5a2

PDB Entry: 2gf5

PDB Description: structure of intact fadd (mort1)

PDB Compounds: (A:) fadd protein

SCOPe Domain Sequences for d2gf5a2:

Sequence; same for both SEQRES and ATOM records:

>d2gf5a2 a.77.1.4 (A:2-83) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
dpflvllhsvssslssseltelkylclgrvgkrklervqsgldlfsmlleqndlepghte
llrellaslrrhdllrrvddfe

Timeline for d2gf5a2:

• d2gf5a2 first appeared in SCOP 1.73
  
• d2gf5a2 appears in SCOPe 2.04
  
• d2gf5a2 appears in SCOPe 2.06
  
• d2gf5a2 appears in the current release, SCOPe 2.08