Lineage for d2gf5a1 (2gf5 A:89-191)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274552Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 1274553Superfamily a.77.1: DEATH domain [47986] (4 families) (S)
  5. 1274554Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 1274555Protein FADD (Mort1) [47992] (2 species)
    contains two domains of this superfamily: DED and DD, in this order
  7. 1274556Species Human (Homo sapiens) [TaxId:9606] [47993] (4 PDB entries)
  8. 1274565Domain d2gf5a1: 2gf5 A:89-191 [135075]
    Other proteins in same PDB: d2gf5a2
    automatically matched to d1e3ya_

Details for d2gf5a1

PDB Entry: 2gf5 (more details)

PDB Description: Structure of intact FADD (MORT1)
PDB Compounds: (A:) fadd protein

SCOPe Domain Sequences for d2gf5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf5a1 a.77.1.2 (A:89-191) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]}
gaapgeedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriw
kntekenatvahlvgalrscqmnlvadlvqevqqardlqnrsg

SCOPe Domain Coordinates for d2gf5a1:

Click to download the PDB-style file with coordinates for d2gf5a1.
(The format of our PDB-style files is described here.)

Timeline for d2gf5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gf5a2