Class a: All alpha proteins [46456] (286 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.10: Vng1086c-like [140371] (1 family) homotetramer; comprises two dimers similar to the antidote epsilon subunit dimer automatically mapped to Pfam PF01893 |
Family a.8.10.1: Vng1086c-like [140372] (1 protein) Pfam PF01893; UPF0058 |
Protein Nypothetical protein Vng1086c [140373] (1 species) |
Species Halobacterium salinarium [TaxId:2242] [140374] (1 PDB entry) Uniprot Q9HQM9 1-89 also Halobacterium halobium |
Domain d2gf4a1: 2gf4 A:1-89 [135074] complexed with act, ca |
PDB Entry: 2gf4 (more details), 2.07 Å
SCOPe Domain Sequences for d2gf4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf4a1 a.8.10.1 (A:1-89) Nypothetical protein Vng1086c {Halobacterium salinarium [TaxId: 2242]} mhkdellelheqmvnikdqflgfdhvdetafaayeeldvepshvhksksehkhavfllgn alaaamsedefssagriskrmeeladdas
Timeline for d2gf4a1: