SCOPe 2.05: Domain d2gf4a1: 2gf4 A:1-89

Lineage for d2gf4a1 (2gf4 A:1-89)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.10: Vng1086c-like [140371] (1 family)
   homotetramer; comprises two dimers similar to the antidote epsilon subunit dimer
   automatically mapped to Pfam PF01893

5. Family a.8.10.1: Vng1086c-like [140372] (1 protein)
   Pfam PF01893; UPF0058

6. Protein Nypothetical protein Vng1086c [140373] (1 species)

7. Species Halobacterium salinarium [TaxId:2242] [140374] (1 PDB entry)
   Uniprot Q9HQM9 1-89
   also Halobacterium halobium

8. Domain d2gf4a1: 2gf4 A:1-89 [135074]
   complexed with act, ca

Details for d2gf4a1

PDB Entry: 2gf4, 2.07 Å

PDB Description: crystal structure of vng1086c from halobacterium salinarium (halobacterium halobium). northeast structural genomics target hsr14

PDB Compounds: (A:) Protein Vng1086c

SCOPe Domain Sequences for d2gf4a1:

Sequence; same for both SEQRES and ATOM records:

>d2gf4a1 a.8.10.1 (A:1-89) Nypothetical protein Vng1086c {Halobacterium salinarium [TaxId: 2242]}
mhkdellelheqmvnikdqflgfdhvdetafaayeeldvepshvhksksehkhavfllgn
alaaamsedefssagriskrmeeladdas

Timeline for d2gf4a1:

• d2gf4a1 first appeared in SCOP 1.73
  
• d2gf4a1 appears in SCOPe 2.04
  
• d2gf4a1 appears in SCOPe 2.06
  
• d2gf4a1 appears in the current release, SCOPe 2.08