SCOPe 2.08: Domain d2gf3b2: 2gf3 B:218-321

Lineage for d2gf3b2 (2gf3 B:218-321)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Sarcosine oxidase [54388] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (17 PDB entries)

8. Domain d2gf3b2: 2gf3 B:218-321 [135073]
   Other proteins in same PDB: d2gf3a1, d2gf3b1
   automated match to d1l9ea2
   complexed with cl, fad, foa, gol, po4

Details for d2gf3b2

PDB Entry: 2gf3, 1.3 Å

PDB Description: Structure of the complex of monomeric sarcosine with its substrate analogue inhibitor 2-furoic acid at 1.3 A resolution.

PDB Compounds: (B:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d2gf3b2:

Sequence; same for both SEQRES and ATOM records:

>d2gf3b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

Timeline for d2gf3b2:

• d2gf3b2 first appeared in SCOP 1.73
  
• d2gf3b2 appears in SCOPe 2.07