Lineage for d2gf3a2 (2gf3 A:218-321)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935373Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)
  6. 2935423Protein Sarcosine oxidase [54388] (1 species)
  7. 2935424Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (17 PDB entries)
  8. 2935425Domain d2gf3a2: 2gf3 A:218-321 [135071]
    Other proteins in same PDB: d2gf3a1, d2gf3b1
    automated match to d1l9ea2
    complexed with cl, fad, foa, gol, po4

Details for d2gf3a2

PDB Entry: 2gf3 (more details), 1.3 Å

PDB Description: Structure of the complex of monomeric sarcosine with its substrate analogue inhibitor 2-furoic acid at 1.3 A resolution.
PDB Compounds: (A:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d2gf3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf3a2 d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

SCOPe Domain Coordinates for d2gf3a2:

Click to download the PDB-style file with coordinates for d2gf3a2.
(The format of our PDB-style files is described here.)

Timeline for d2gf3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gf3a1