Lineage for d2gf0c1 (2gf0 C:6-176)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830125Protein di-Ras1 [142277] (1 species)
  7. 830126Species Human (Homo sapiens) [TaxId:9606] [142278] (1 PDB entry)
    Uniprot O95057 4-176
  8. 830129Domain d2gf0c1: 2gf0 C:6-176 [135068]
    automatically matched to 2GF0 A:4-176
    complexed with gdp, mg

Details for d2gf0c1

PDB Entry: 2gf0 (more details), 1.9 Å

PDB Description: The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
PDB Compounds: (C:) GTP-binding protein Di-Ras1

SCOP Domain Sequences for d2gf0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf0c1 c.37.1.8 (C:6-176) di-Ras1 {Human (Homo sapiens) [TaxId: 9606]}
ndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdttgs
hqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkcde
tqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln

SCOP Domain Coordinates for d2gf0c1:

Click to download the PDB-style file with coordinates for d2gf0c1.
(The format of our PDB-style files is described here.)

Timeline for d2gf0c1: