SCOP 1.73: Domain d2gf0b1: 2gf0 B:4-176

Lineage for d2gf0b1 (2gf0 B:4-176)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein di-Ras1 [142277] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142278] (1 PDB entry)

8. Domain d2gf0b1: 2gf0 B:4-176 [135067]
   automatically matched to 2GF0 A:4-176
   complexed with gdp, mg

Details for d2gf0b1

PDB Entry: 2gf0, 1.9 Å

PDB Description: The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state

PDB Compounds: (B:) GTP-binding protein Di-Ras1

SCOP Domain Sequences for d2gf0b1:

Sequence; same for both SEQRES and ATOM records:

>d2gf0b1 c.37.1.8 (B:4-176) di-Ras1 {Human (Homo sapiens) [TaxId: 9606]}
qsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdtt
gshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkc
detqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln

Timeline for d2gf0b1:

• d2gf0b1 is new in SCOP 1.73
  
• d2gf0b1 appears in SCOP 1.75
  
• d2gf0b1 appears in the current release, SCOPe 2.08, called d2gf0b_