![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein di-Ras1 [142277] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142278] (1 PDB entry) |
![]() | Domain d2gf0b1: 2gf0 B:4-176 [135067] automatically matched to 2GF0 A:4-176 complexed with gdp, mg |
PDB Entry: 2gf0 (more details), 1.9 Å
SCOP Domain Sequences for d2gf0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf0b1 c.37.1.8 (B:4-176) di-Ras1 {Human (Homo sapiens) [TaxId: 9606]} qsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdtt gshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkc detqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln
Timeline for d2gf0b1: