Lineage for d2gf0b_ (2gf0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867061Protein di-Ras1 [142277] (1 species)
  7. 2867062Species Human (Homo sapiens) [TaxId:9606] [142278] (1 PDB entry)
    Uniprot O95057 4-176
  8. 2867064Domain d2gf0b_: 2gf0 B: [135067]
    automated match to d2gf0a1
    complexed with gdp, mg

Details for d2gf0b_

PDB Entry: 2gf0 (more details), 1.9 Å

PDB Description: The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state
PDB Compounds: (B:) GTP-binding protein Di-Ras1

SCOPe Domain Sequences for d2gf0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gf0b_ c.37.1.8 (B:) di-Ras1 {Human (Homo sapiens) [TaxId: 9606]}
eqsndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdt
tgshqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnk
cdetqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln

SCOPe Domain Coordinates for d2gf0b_:

Click to download the PDB-style file with coordinates for d2gf0b_.
(The format of our PDB-style files is described here.)

Timeline for d2gf0b_: