SCOPe 2.06: Domain d2gewa2: 2gew A:319-450

Lineage for d2gewa2 (2gew A:319-450)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Cholesterol oxidase [54375] (3 species)

7. Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries)

8. Domain d2gewa2: 2gew A:319-450 [135065]
   Other proteins in same PDB: d2gewa1
   automated match to d1n4wa2
   complexed with fad, oxy, so4

Details for d2gewa2

PDB Entry: 2gew, 0.97 Å

PDB Description: atomic resolution structure of cholesterol oxidase @ ph 9.0 (streptomyces sp. sa-coo)

PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d2gewa2:

Sequence; same for both SEQRES and ATOM records:

>d2gewa2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg

Timeline for d2gewa2:

• d2gewa2 first appeared in SCOP 1.73
  
• d2gewa2 appears in SCOPe 2.05
  
• d2gewa2 appears in SCOPe 2.07
  
• d2gewa2 appears in the current release, SCOPe 2.08