Lineage for d2gewa2 (2gew A:319-450)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935246Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 2935247Protein Cholesterol oxidase [54375] (3 species)
  7. 2935253Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries)
  8. 2935262Domain d2gewa2: 2gew A:319-450 [135065]
    Other proteins in same PDB: d2gewa1
    automated match to d1n4wa2
    complexed with fad, oxy, so4

Details for d2gewa2

PDB Entry: 2gew (more details), 0.97 Å

PDB Description: atomic resolution structure of cholesterol oxidase @ ph 9.0 (streptomyces sp. sa-coo)
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d2gewa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gewa2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg

SCOPe Domain Coordinates for d2gewa2:

Click to download the PDB-style file with coordinates for d2gewa2.
(The format of our PDB-style files is described here.)

Timeline for d2gewa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gewa1