Lineage for d2gewa1 (2gew A:8-318,A:451-508)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2457696Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2457697Protein Cholesterol oxidase of GMC family [51914] (3 species)
  7. 2457703Species Streptomyces sp. [TaxId:1931] [51916] (14 PDB entries)
  8. 2457708Domain d2gewa1: 2gew A:8-318,A:451-508 [135064]
    Other proteins in same PDB: d2gewa2
    automated match to d1n4wa1
    complexed with fad, oxy, so4

Details for d2gewa1

PDB Entry: 2gew (more details), 0.97 Å

PDB Description: atomic resolution structure of cholesterol oxidase @ ph 9.0 (streptomyces sp. sa-coo)
PDB Compounds: (A:) cholesterol oxidase

SCOPe Domain Sequences for d2gewa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gewa1 c.3.1.2 (A:8-318,A:451-508) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}
ggyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrssw
fknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepk
rsyfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglg
tvfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtl
hqvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtl
pnlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernv
eriikqdvta

SCOPe Domain Coordinates for d2gewa1:

Click to download the PDB-style file with coordinates for d2gewa1.
(The format of our PDB-style files is described here.)

Timeline for d2gewa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gewa2