Lineage for d2gena2 (2gen A:76-193)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Probable transcriptional regulator PA1836 [140881] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [140882] (1 PDB entry)
Uniprot Q9I2Q9 76-193
Domain d2gena2: 2gen A:76-193 [135063]
Other proteins in same PDB: d2gena1
Details for d2gena2
PDB Entry: 2gen (more details), 1.7 Å
PDB Description: Structural Genomics, the crystal structure of a probable transcriptional regulator from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) probable transcriptional regulatorSCOPe Domain Sequences for d2gena2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gena2 a.121.1.1 (A:76-193) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]}
rsaeetvrllvtsyidwvvanpdwarfilhsrgrveagelgerlradnqahfarihaala
gyraeglfrempddcfasvvigpahdlarqwlagrtrvaladcrellaqvawdsvraa
SCOPe Domain Coordinates for d2gena2:
Click to download the PDB-style file with coordinates for d2gena2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2gena2:
- d2gena2 first appeared in SCOP 1.73
- d2gena2 appears in SCOPe 2.07
View in 3D
