SCOP 1.75: Domain d2gena1: 2gen A:6-75

Lineage for d2gena1 (2gen A:6-75)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Probable transcriptional regulator PA1836 [140201] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140202] (1 PDB entry)
   Uniprot Q9I2Q9 6-75

8. Domain d2gena1: 2gen A:6-75 [135062]
   Other proteins in same PDB: d2gena2

Details for d2gena1

PDB Entry: 2gen, 1.7 Å

PDB Description: Structural Genomics, the crystal structure of a probable transcriptional regulator from Pseudomonas aeruginosa PAO1

PDB Compounds: (A:) probable transcriptional regulator

SCOP Domain Sequences for d2gena1:

Sequence; same for both SEQRES and ATOM records:

>d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]}
rkdeilqaalacfsehgvdattiemirdrsgasigslyhhfgnkerihgelylagigqya
alleagfara

Timeline for d2gena1:

• d2gena1 first appeared in SCOP 1.73
  
• d2gena1 appears in SCOPe 2.01
  
• d2gena1 appears in the current release, SCOPe 2.08