Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (19 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins) |
Protein Probable transcriptional regulator PA1836 [140201] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [140202] (1 PDB entry) Uniprot Q9I2Q9 6-75 |
Domain d2gena1: 2gen A:6-75 [135062] Other proteins in same PDB: d2gena2 |
PDB Entry: 2gen (more details), 1.7 Å
SCOP Domain Sequences for d2gena1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} rkdeilqaalacfsehgvdattiemirdrsgasigslyhhfgnkerihgelylagigqya alleagfara
Timeline for d2gena1: