![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (17 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (28 proteins) |
![]() | Protein Probable transcriptional regulator PA1836 [140201] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [140202] (1 PDB entry) |
![]() | Domain d2gena1: 2gen A:6-75 [135062] Other proteins in same PDB: d2gena2 |
PDB Entry: 2gen (more details), 1.7 Å
SCOP Domain Sequences for d2gena1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]} rkdeilqaalacfsehgvdattiemirdrsgasigslyhhfgnkerihgelylagigqya alleagfara
Timeline for d2gena1: