Lineage for d2gena1 (2gen A:6-75)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634637Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (28 proteins)
  6. 634712Protein Probable transcriptional regulator PA1836 [140201] (1 species)
  7. 634713Species Pseudomonas aeruginosa [TaxId:287] [140202] (1 PDB entry)
  8. 634714Domain d2gena1: 2gen A:6-75 [135062]
    Other proteins in same PDB: d2gena2

Details for d2gena1

PDB Entry: 2gen (more details), 1.7 Å

PDB Description: Structural Genomics, the crystal structure of a probable transcriptional regulator from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) probable transcriptional regulator

SCOP Domain Sequences for d2gena1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]}
rkdeilqaalacfsehgvdattiemirdrsgasigslyhhfgnkerihgelylagigqya
alleagfara

SCOP Domain Coordinates for d2gena1:

Click to download the PDB-style file with coordinates for d2gena1.
(The format of our PDB-style files is described here.)

Timeline for d2gena1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gena2