SCOPe 2.07: Domain d2gecb_: 2gec B:

Lineage for d2gecb_ (2gec B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.148: Coronavirus RNA-binding domain [110303] (1 superfamily)
   coiled antiparallel beta-sheet of 5 strands, order 51324; complex topology, crossing loops

4. Superfamily b.148.1: Coronavirus RNA-binding domain [110304] (1 family)
   automatically mapped to Pfam PF00937

5. Family b.148.1.1: Coronavirus RNA-binding domain [110305] (1 protein)
   N-terminal part of Pfam PF00937

6. Protein Nucleocapsid protein [110306] (2 species)

7. Species Avian infectious bronchitis virus [TaxId:11120] [141560] (4 PDB entries)
   Uniprot P32923 23-160! Uniprot P69596 29-160! Uniprot P69597 29-160
   different strains

8. Domain d2gecb_: 2gec B: [135060]
   automated match to d2geca1

Details for d2gecb_

PDB Entry: 2gec, 1.3 Å

PDB Description: Structure of the N-terminal domain of avian infectious bronchitis virus nucleocapsid protein (strain Gray) in a novel dimeric arrangement

PDB Compounds: (B:) nucleocapsid protein

SCOPe Domain Sequences for d2gecb_:

Sequence; same for both SEQRES and ATOM records:

>d2gecb_ b.148.1.1 (B:) Nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]}
prppkvgssgnaswfqaikakklnspqpkfegsgvpdnenlktsqqhgywrrqarfkpgk
grrkpvpdawyfyytgtgpaadlnwgdsqdgivwvaakgadvksrsnqgtrdpdkfdqyp
lrfsdggpdgnfrwdfipl

Timeline for d2gecb_:

• d2gecb_ first appeared in SCOP 1.73, called d2gecb1
  
• d2gecb_ appears in SCOPe 2.06
  
• d2gecb_ appears in the current release, SCOPe 2.08