Lineage for d2gecb1 (2gec B:23-160)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680858Fold b.148: Coronavirus RNA-binding domain [110303] (1 superfamily)
    coiled antiparallel beta-sheet of 5 strands, order 51324; complex topology, crossing loops
  4. 680859Superfamily b.148.1: Coronavirus RNA-binding domain [110304] (1 family) (S)
  5. 680860Family b.148.1.1: Coronavirus RNA-binding domain [110305] (1 protein)
    N-terminal part of Pfam PF00937
  6. 680861Protein Nucleocapsid protein [110306] (2 species)
  7. 680862Species Avian infectious bronchitis virus [TaxId:11120] [141560] (4 PDB entries)
    different strains
  8. 680864Domain d2gecb1: 2gec B:23-160 [135060]
    automatically matched to 2GEC A:23-160

Details for d2gecb1

PDB Entry: 2gec (more details), 1.3 Å

PDB Description: Structure of the N-terminal domain of avian infectious bronchitis virus nucleocapsid protein (strain Gray) in a novel dimeric arrangement
PDB Compounds: (B:) nucleocapsid protein

SCOP Domain Sequences for d2gecb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gecb1 b.148.1.1 (B:23-160) Nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]}
rppkvgssgnaswfqaikakklnspqpkfegsgvpdnenlktsqqhgywrrqarfkpgkg
rrkpvpdawyfyytgtgpaadlnwgdsqdgivwvaakgadvksrsnqgtrdpdkfdqypl
rfsdggpdgnfrwdfipl

SCOP Domain Coordinates for d2gecb1:

Click to download the PDB-style file with coordinates for d2gecb1.
(The format of our PDB-style files is described here.)

Timeline for d2gecb1: