Lineage for d2ge8c_ (2ge8 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614712Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 2614713Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) (S)
  5. 2614724Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins)
    C-terminal part of Pfam PF00937
  6. 2614725Protein Coronavirus nucleocapsid protein [143509] (2 species)
  7. 2614726Species Avian infectious bronchitis virus [TaxId:11120] [143510] (3 PDB entries)
    Uniprot P32923 222-333! Uniprot P32923 226-332! Uniprot Q4ZJS4 218-326
    different strains
  8. 2614729Domain d2ge8c_: 2ge8 C: [135053]
    automated match to d2ge8a1
    protein/RNA complex

Details for d2ge8c_

PDB Entry: 2ge8 (more details), 2.2 Å

PDB Description: Structure of the C-terminal dimerization domain of infectious bronchitis virus nucleocapsid protein
PDB Compounds: (C:) nucleocapsid protein

SCOPe Domain Sequences for d2ge8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ge8c_ d.254.1.2 (C:) Coronavirus nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]}
rryckrtippgykvdqvfgprtkgkegnfgddkmneegikdgrvtamlnlvpsshaclfg
srvtpklqpdglhlkfefttvvprddpqfdnyvkicdqcvdgvgtrpkd

SCOPe Domain Coordinates for d2ge8c_:

Click to download the PDB-style file with coordinates for d2ge8c_.
(The format of our PDB-style files is described here.)

Timeline for d2ge8c_: