SCOP 1.75: Domain d2ge7b1: 2ge7 B:8-114

Lineage for d2ge7b1 (2ge7 B:8-114)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
   dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta

4. Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families)

5. Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (1 protein)
   C-terminal part of Pfam PF00937

6. Protein Coronavirus nucleocapsid protein [143509] (2 species)

7. Species Avian infectious bronchitis virus [TaxId:11120] [143510] (3 PDB entries)
   Uniprot P32923 222-333! Uniprot P32923 226-332! Uniprot Q4ZJS4 218-326
   different strains

8. Domain d2ge7b1: 2ge7 B:8-114 [135050]
   automatically matched to 2GE7 A:8-114

Details for d2ge7b1

PDB Entry: 2ge7, 2 Å

PDB Description: structure of the c-terminal dimerization domain of infectious bronchitis virus nucleocapsid protein

PDB Compounds: (B:) nucleocapsid protein

SCOP Domain Sequences for d2ge7b1:

Sequence; same for both SEQRES and ATOM records:

>d2ge7b1 d.254.1.2 (B:8-114) Coronavirus nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]}
ryckrtippgykvdqvfgprtkgkegnfgddkmneegikdgrvtamlnlvpsshaclfgs
rvtpklqpdglhlkfefttvvprddpqfdnyvkicdqcvdgvgtrpk

Timeline for d2ge7b1:

• d2ge7b1 first appeared in SCOP 1.73
  
• d2ge7b1 is called d2ge7b_ in SCOPe 2.01
  
• d2ge7b1 appears in the current release, SCOPe 2.08, called d2ge7b_