![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily) dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta |
![]() | Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) ![]() |
![]() | Family d.254.1.2: Coronavirus nucleocapsid protein [143508] (2 proteins) C-terminal part of Pfam PF00937 |
![]() | Protein Coronavirus nucleocapsid protein [143509] (2 species) |
![]() | Species Avian infectious bronchitis virus [TaxId:11120] [143510] (3 PDB entries) Uniprot P32923 222-333! Uniprot P32923 226-332! Uniprot Q4ZJS4 218-326 different strains |
![]() | Domain d2ge7b_: 2ge7 B: [135050] automated match to d2ge8a1 protein/RNA complex |
PDB Entry: 2ge7 (more details), 2 Å
SCOPe Domain Sequences for d2ge7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ge7b_ d.254.1.2 (B:) Coronavirus nucleocapsid protein {Avian infectious bronchitis virus [TaxId: 11120]} ryckrtippgykvdqvfgprtkgkegnfgddkmneegikdgrvtamlnlvpsshaclfgs rvtpklqpdglhlkfefttvvprddpqfdnyvkicdqcvdgvgtrpkd
Timeline for d2ge7b_: