SCOPe 2.08: Domain d2ge4a_: 2ge4 A:

Lineage for d2ge4a_ (2ge4 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.1: Outer membrane protein [56926] (3 proteins)
   automatically mapped to Pfam PF13505

6. Protein Outer membrane protein A (OMPA) transmembrane domain [56927] (1 species)

7. Species Escherichia coli [TaxId:562] [56928] (5 PDB entries)

8. Domain d2ge4a_: 2ge4 A: [135048]
   automated match to d1g90a_

Details for d2ge4a_

PDB Entry: 2ge4

PDB Description: high-resolution solution structure of outer membrane protein a transmembrane domain

PDB Compounds: (A:) outer membrane protein a

SCOPe Domain Sequences for d2ge4a_:

Sequence; same for both SEQRES and ATOM records:

>d2ge4a_ f.4.1.1 (A:) Outer membrane protein A (OMPA) transmembrane domain {Escherichia coli [TaxId: 562]}
mapkdntwytgaklgfsqyhdtgfinnngpthenqlgagafggyqvnpyvgfemgydflg
rmpykgsvengaykaqgvqltaklgypitddldiytrlggmvfradtksnvygknhdtgv
spvfaggveyaitpeiatrleyqftnnigdahtigtrpdngmlslgvsyrfgqgeaa

Timeline for d2ge4a_:

• d2ge4a_ first appeared in SCOP 1.73, called d2ge4a1
  
• d2ge4a_ appears in SCOPe 2.07