Lineage for d2ge3d_ (2ge3 D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein automated matches [190241] (13 species)
    not a true protein
  7. Species Agrobacterium tumefaciens [TaxId:358] [187748] (1 PDB entry)
  8. Domain d2ge3d_: 2ge3 D: [135047]
    Other proteins in same PDB: d2ge3a1
    automated match to d2ge3a1
    complexed with aco

Details for d2ge3d_

PDB Entry: 2ge3 (more details), 2.25 Å

PDB Description: Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens
PDB Compounds: (D:) Probable acetyltransferase

SCOPe Domain Sequences for d2ge3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ge3d_ d.108.1.1 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
tvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaiad
gdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhrielsv
hadnaraialyekigfahegrardavsidghyidslnmaiifgn

SCOPe Domain Coordinates for d2ge3d_ are not available.

Timeline for d2ge3d_:

Domains from other chains:
(mouse over for more information)
d2ge3a1, d2ge3b_, d2ge3c_