Lineage for d2gdza1 (2gdz A:3-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841547Protein 15-hydroxyprostaglandin dehydrogenase, PGDH [141888] (1 species)
  7. 2841548Species Human (Homo sapiens) [TaxId:9606] [141889] (1 PDB entry)
    Uniprot P15428 3-256
  8. 2841549Domain d2gdza1: 2gdz A:3-256 [135043]
    Other proteins in same PDB: d2gdza2, d2gdza3
    complexed with nad

Details for d2gdza1

PDB Entry: 2gdz (more details), 1.65 Å

PDB Description: Crystal structure of 15-hydroxyprostaglandin dehydrogenase type1, complexed with NAD+
PDB Compounds: (A:) NAD+-dependent 15-hydroxyprostaglandin dehydrogenase

SCOPe Domain Sequences for d2gdza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]}
vngkvalvtgaaqgigrafaealllkgakvalvdwnleagvqckaalheqfepqktlfiq
cdvadqqqlrdtfrkvvdhfgrldilvnnagvnneknwektlqinlvsvisgtylgldym
skqnggeggiiinmsslaglmpvaqqpvycaskhgivgftrsaalaanlmnsgvrlnaic
pgfvntailesiekeenmgqyieykdhikdmikyygildpplianglitlieddalngai
mkittskgihfqdy

SCOPe Domain Coordinates for d2gdza1:

Click to download the PDB-style file with coordinates for d2gdza1.
(The format of our PDB-style files is described here.)

Timeline for d2gdza1: