Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein 15-hydroxyprostaglandin dehydrogenase, PGDH [141888] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141889] (1 PDB entry) Uniprot P15428 3-256 |
Domain d2gdza1: 2gdz A:3-256 [135043] Other proteins in same PDB: d2gdza2, d2gdza3 complexed with nad |
PDB Entry: 2gdz (more details), 1.65 Å
SCOPe Domain Sequences for d2gdza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} vngkvalvtgaaqgigrafaealllkgakvalvdwnleagvqckaalheqfepqktlfiq cdvadqqqlrdtfrkvvdhfgrldilvnnagvnneknwektlqinlvsvisgtylgldym skqnggeggiiinmsslaglmpvaqqpvycaskhgivgftrsaalaanlmnsgvrlnaic pgfvntailesiekeenmgqyieykdhikdmikyygildpplianglitlieddalngai mkittskgihfqdy
Timeline for d2gdza1: