Lineage for d2gdya_ (2gdy A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731062Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1731161Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 1731162Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 1731163Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)
  8. 1731170Domain d2gdya_: 2gdy A: [135042]
    automated match to d1dnya_

Details for d2gdya_

PDB Entry: 2gdy (more details)

PDB Description: solution structure of the b. brevis tycc3-pcp in a-state
PDB Compounds: (A:) Tyrocidine synthetase III

SCOPe Domain Sequences for d2gdya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdya_ a.28.1.2 (A:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
velplkvlfaqptikalaqyvatrs

SCOPe Domain Coordinates for d2gdya_:

Click to download the PDB-style file with coordinates for d2gdya_.
(The format of our PDB-style files is described here.)

Timeline for d2gdya_: