Lineage for d2gdxa2 (2gdx A:1-83)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993361Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1993466Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 1993467Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 1993468Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)
  8. 1993474Domain d2gdxa2: 2gdx A:1-83 [135041]
    Other proteins in same PDB: d2gdxa3
    automated match to d1dnya_

Details for d2gdxa2

PDB Entry: 2gdx (more details)

PDB Description: solution structure of the b. brevis tycc3-pcp in h-state
PDB Compounds: (A:) Tyrocidine synthetase III

SCOPe Domain Sequences for d2gdxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdxa2 a.28.1.2 (A:1-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
velplkvlfaqptikalaqyvat

SCOPe Domain Coordinates for d2gdxa2:

Click to download the PDB-style file with coordinates for d2gdxa2.
(The format of our PDB-style files is described here.)

Timeline for d2gdxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gdxa3