SCOPe 2.04: Domain d2gdxa_: 2gdx A:

Lineage for d2gdxa_ (2gdx A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)

6. Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)

7. Species Bacillus brevis [TaxId:1393] [47344] (6 PDB entries)

8. Domain d2gdxa_: 2gdx A: [135041]
   automated match to d1dnya_

Details for d2gdxa_

PDB Entry: 2gdx

PDB Description: solution structure of the b. brevis tycc3-pcp in h-state

PDB Compounds: (A:) Tyrocidine synthetase III

SCOPe Domain Sequences for d2gdxa_:

Sequence; same for both SEQRES and ATOM records:

>d2gdxa_ a.28.1.2 (A:) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
velplkvlfaqptikalaqyvatrs

Timeline for d2gdxa_:

• d2gdxa_ first appeared in SCOP 1.73, called d2gdxa1
  
• d2gdxa_ was called d2gdxa1 in SCOPe 2.03
  
• d2gdxa_ appears in SCOPe 2.05
  
• d2gdxa_ appears in the current release, SCOPe 2.08, called d2gdxa2