![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein) |
![]() | Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species) |
![]() | Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries) |
![]() | Domain d2gdxa2: 2gdx A:1-83 [135041] Other proteins in same PDB: d2gdxa3 automated match to d1dnya_ |
PDB Entry: 2gdx (more details)
SCOPe Domain Sequences for d2gdxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdxa2 a.28.1.2 (A:1-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq velplkvlfaqptikalaqyvat
Timeline for d2gdxa2: