Lineage for d2gdwa1 (2gdw A:8-83)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266817Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1266818Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1266912Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 1266913Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 1266914Species Bacillus brevis [TaxId:1393] [47344] (4 PDB entries)
  8. 1266915Domain d2gdwa1: 2gdw A:8-83 [135040]
    automatically matched to d1dnya_

Details for d2gdwa1

PDB Entry: 2gdw (more details)

PDB Description: solution structure of the b. brevis tycc3-pcp in a/h-state
PDB Compounds: (A:) Tyrocidine synthetase III

SCOPe Domain Sequences for d2gdwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
yvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqvelplkv
lfaqptikalaqyvat

SCOPe Domain Coordinates for d2gdwa1:

Click to download the PDB-style file with coordinates for d2gdwa1.
(The format of our PDB-style files is described here.)

Timeline for d2gdwa1: