Lineage for d2gdwa1 (2gdw A:8-83)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639734Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 639735Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 639773Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)
  6. 639774Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)
  7. 639775Species Bacillus brevis [TaxId:1393] [47344] (4 PDB entries)
  8. 639777Domain d2gdwa1: 2gdw A:8-83 [135040]
    automatically matched to d1dnya_
    mutant

Details for d2gdwa1

PDB Entry: 2gdw (more details)

PDB Description: solution structure of the b. brevis tycc3-pcp in a/h-state
PDB Compounds: (A:) Tyrocidine synthetase III

SCOP Domain Sequences for d2gdwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
yvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqvelplkv
lfaqptikalaqyvat

SCOP Domain Coordinates for d2gdwa1:

Click to download the PDB-style file with coordinates for d2gdwa1.
(The format of our PDB-style files is described here.)

Timeline for d2gdwa1: