SCOP 1.73: Domain d2gdwa1: 2gdw A:8-83

Lineage for d2gdwa1 (2gdw A:8-83)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (3 families)

5. Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)

6. Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)

7. Species Bacillus brevis [TaxId:1393] [47344] (4 PDB entries)

8. Domain d2gdwa1: 2gdw A:8-83 [135040]
   automatically matched to d1dnya_
   mutant

Details for d2gdwa1

PDB Entry: 2gdw

PDB Description: solution structure of the b. brevis tycc3-pcp in a/h-state

PDB Compounds: (A:) Tyrocidine synthetase III

SCOP Domain Sequences for d2gdwa1:

Sequence; same for both SEQRES and ATOM records:

>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
yvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyqvelplkv
lfaqptikalaqyvat

Timeline for d2gdwa1:

• d2gdwa1 is new in SCOP 1.73
  
• d2gdwa1 appears in SCOP 1.75
  
• d2gdwa1 appears in the current release, SCOPe 2.08, called d2gdwa2