SCOPe 2.08: Domain d2gdwa2: 2gdw A:1-83

Lineage for d2gdwa2 (2gdw A:1-83)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.2: Peptidyl carrier domain [47342] (1 protein)

6. Protein Peptidyl carrier protein (PCP), thioester domain [47343] (1 species)

7. Species Bacillus brevis [TaxId:1393] [47344] (7 PDB entries)

8. Domain d2gdwa2: 2gdw A:1-83 [135040]
   Other proteins in same PDB: d2gdwa3
   automated match to d2gdwa1

Details for d2gdwa2

PDB Entry: 2gdw

PDB Description: solution structure of the b. brevis tycc3-pcp in a/h-state

PDB Compounds: (A:) Tyrocidine synthetase III

SCOPe Domain Sequences for d2gdwa2:

Sequence; same for both SEQRES and ATOM records:

>d2gdwa2 a.28.1.2 (A:1-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]}
mgvteaqyvaptnavesklaeiwervlgvsgigildnffqigghslkamavaaqvhreyq
velplkvlfaqptikalaqyvat

Timeline for d2gdwa2:

• d2gdwa2 first appeared in SCOP 1.73, called d2gdwa1
  
• d2gdwa2 appears in SCOPe 2.07