SCOP 1.73: Domain d2gdvb2: 2gdv B:1-434

Lineage for d2gdvb2 (2gdv B:1-434)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Sucrose phosphorylase [102060] (1 species)
   sequence and close structural relationship to amylosucrase; variations in the C-terminal domain fold

7. Species Bifidobacterium adolescentis [TaxId:1680] [102061] (3 PDB entries)

8. Domain d2gdvb2: 2gdv B:1-434 [135039]
   Other proteins in same PDB: d2gdva1, d2gdvb1
   automatically matched to d1r7aa2
   complexed with glc

Details for d2gdvb2

PDB Entry: 2gdv, 2 Å

PDB Description: sucrose phosphorylase from bifidobacterium adolescentis reacted with sucrose

PDB Compounds: (B:) sucrose phosphorylase

SCOP Domain Sequences for d2gdvb2:

Sequence; same for both SEQRES and ATOM records:

>d2gdvb2 c.1.8.1 (B:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

Timeline for d2gdvb2:

• d2gdvb2 is new in SCOP 1.73
  
• d2gdvb2 appears in SCOP 1.75
  
• d2gdvb2 appears in the current release, SCOPe 2.08