SCOPe 2.06: Domain d2gdvb1: 2gdv B:435-504

Lineage for d2gdvb1 (2gdv B:435-504)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Sucrose phosphorylase [101920] (1 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Bifidobacterium adolescentis [TaxId:1680] [101921] (2 PDB entries)

8. Domain d2gdvb1: 2gdv B:435-504 [135038]
   Other proteins in same PDB: d2gdva2, d2gdvb2
   automated match to d1r7aa1
   complexed with bgc

Details for d2gdvb1

PDB Entry: 2gdv, 2 Å

PDB Description: sucrose phosphorylase from bifidobacterium adolescentis reacted with sucrose

PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d2gdvb1:

Sequence; same for both SEQRES and ATOM records:

>d2gdvb1 b.71.1.1 (B:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

Timeline for d2gdvb1:

• d2gdvb1 first appeared in SCOP 1.73
  
• d2gdvb1 appears in SCOPe 2.05
  
• d2gdvb1 appears in SCOPe 2.07
  
• d2gdvb1 appears in the current release, SCOPe 2.08