![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Sucrose phosphorylase [101920] (1 species) single beta-sheet; probable result of a decay of the common-fold |
![]() | Species Bifidobacterium adolescentis [TaxId:1680] [101921] (2 PDB entries) |
![]() | Domain d2gdva1: 2gdv A:435-504 [135036] Other proteins in same PDB: d2gdva2, d2gdvb2 automated match to d1r7aa1 complexed with bgc |
PDB Entry: 2gdv (more details), 2 Å
SCOPe Domain Sequences for d2gdva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdva1 b.71.1.1 (A:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd dlianppvva
Timeline for d2gdva1: