Lineage for d2gdub2 (2gdu B:1-434)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818647Protein automated matches [190099] (22 species)
    not a true protein
  7. 1818687Species Bifidobacterium adolescentis [TaxId:1680] [255183] (1 PDB entry)
  8. 1818689Domain d2gdub2: 2gdu B:1-434 [135035]
    Other proteins in same PDB: d2gdua1, d2gdub1
    automated match to d1r7aa2
    complexed with suc; mutant

Details for d2gdub2

PDB Entry: 2gdu (more details), 2.1 Å

PDB Description: e232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose
PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d2gdub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdub2 c.1.8.1 (B:1-434) automated matches {Bifidobacterium adolescentis [TaxId: 1680]}
mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk
vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp
ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq
maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleiliqvhsyykkq
veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd
qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh
yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv
kalnalakfrneld

SCOPe Domain Coordinates for d2gdub2:

Click to download the PDB-style file with coordinates for d2gdub2.
(The format of our PDB-style files is described here.)

Timeline for d2gdub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gdub1