Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Bifidobacterium adolescentis [TaxId:1680] [255184] (4 PDB entries) |
Domain d2gdub1: 2gdu B:435-504 [135034] Other proteins in same PDB: d2gdua2, d2gdub2 automated match to d1r7aa1 mutant |
PDB Entry: 2gdu (more details), 2.1 Å
SCOPe Domain Sequences for d2gdub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdub1 b.71.1.0 (B:435-504) automated matches {Bifidobacterium adolescentis [TaxId: 1680]} afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd dlianppvva
Timeline for d2gdub1: