SCOPe 2.08: Domain d2gdsc2: 2gds C:84-198

Lineage for d2gdsc2 (2gds C:84-198)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries)

8. Domain d2gdsc2: 2gds C:84-198 [135029]
   Other proteins in same PDB: d2gdsa1, d2gdsb1, d2gdsc1, d2gdsd1
   automated match to d2p4ka2
   complexed with mn

Details for d2gdsc2

PDB Entry: 2gds, 2.3 Å

PDB Description: interrupting the hydrogen bonding network at the active site of human manganese superoxide dismutase

PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d2gdsc2:

Sequence; same for both SEQRES and ATOM records:

>d2gdsc2 d.44.1.1 (C:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d2gdsc2:

• d2gdsc2 first appeared in SCOP 1.73
  
• d2gdsc2 appears in SCOPe 2.07