Lineage for d2gdsb2 (2gds B:84-198)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722119Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 722120Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 722121Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 722247Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)
  7. 722300Species Human (Homo sapiens) [TaxId:9606] [54724] (23 PDB entries)
  8. 722340Domain d2gdsb2: 2gds B:84-198 [135027]
    Other proteins in same PDB: d2gdsa1, d2gdsb1, d2gdsc1, d2gdsd1
    automatically matched to d1em1a2
    complexed with mn; mutant

Details for d2gdsb2

PDB Entry: 2gds (more details), 2.3 Å

PDB Description: interrupting the hydrogen bonding network at the active site of human manganese superoxide dismutase
PDB Compounds: (B:) superoxide dismutase

SCOP Domain Sequences for d2gdsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdsb2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d2gdsb2:

Click to download the PDB-style file with coordinates for d2gdsb2.
(The format of our PDB-style files is described here.)

Timeline for d2gdsb2: