SCOP 1.73: Domain d2gdsb1: 2gds B:1-83

Lineage for d2gdsb1 (2gds B:1-83)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (23 PDB entries)

8. Domain d2gdsb1: 2gds B:1-83 [135026]
   Other proteins in same PDB: d2gdsa2, d2gdsb2, d2gdsc2, d2gdsd2
   automatically matched to d1em1a1
   complexed with mn; mutant

Details for d2gdsb1

PDB Entry: 2gds, 2.3 Å

PDB Description: interrupting the hydrogen bonding network at the active site of human manganese superoxide dismutase

PDB Compounds: (B:) superoxide dismutase

SCOP Domain Sequences for d2gdsb1:

Sequence; same for both SEQRES and ATOM records:

>d2gdsb1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d2gdsb1:

• d2gdsb1 is new in SCOP 1.73
  
• d2gdsb1 appears in SCOP 1.75
  
• d2gdsb1 appears in the current release, SCOPe 2.08