Lineage for d2gdsa2 (2gds A:84-198)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2169542Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2169543Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2169544Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 protein domains)
  6. 2169670Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2169734Species Human (Homo sapiens) [TaxId:9606] [54724] (30 PDB entries)
  8. 2169777Domain d2gdsa2: 2gds A:84-198 [135025]
    Other proteins in same PDB: d2gdsa1, d2gdsb1, d2gdsc1, d2gdsd1
    automated match to d2p4ka2
    complexed with mn

Details for d2gdsa2

PDB Entry: 2gds (more details), 2.3 Å

PDB Description: Interrupting the Hydrogen Bonding Network at the Active Site of Human Manganese Superoxide Dismutase
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d2gdsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdsa2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d2gdsa2:

Click to download the PDB-style file with coordinates for d2gdsa2.
(The format of our PDB-style files is described here.)

Timeline for d2gdsa2: