![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein Hypothetical protein YitF [143248] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [143249] (2 PDB entries) Uniprot O06741 1-114 |
![]() | Domain d2gdqb2: 2gdq B:5-118 [135023] Other proteins in same PDB: d2gdqa1, d2gdqa3, d2gdqa4, d2gdqb1, d2gdqb3, d2gdqb4 automated match to d2gdqa2 |
PDB Entry: 2gdq (more details), 1.8 Å
SCOPe Domain Sequences for d2gdqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdqb2 d.54.1.1 (B:5-118) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} kivrietfplfhrlekpygdangfkryrtcyliriitesgidgwgecvdwlpalhvgftk riipfllgkqagsrlslvrtiqkwhqraasavsmalteiaakaadcsvcelwgg
Timeline for d2gdqb2:
![]() Domains from other chains: (mouse over for more information) d2gdqa1, d2gdqa2, d2gdqa3, d2gdqa4 |