Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein Hypothetical protein YitF [141844] (1 species) |
Species Bacillus subtilis [TaxId:1423] [141845] (2 PDB entries) Uniprot O06741 115-371 |
Domain d2gdqb1: 2gdq B:119-374 [135022] Other proteins in same PDB: d2gdqa2, d2gdqa3, d2gdqa4, d2gdqb2, d2gdqb3, d2gdqb4 automated match to d2gdqa1 |
PDB Entry: 2gdq (more details), 1.8 Å
SCOPe Domain Sequences for d2gdqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdqb1 c.1.11.2 (B:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]} ryreeipvyasfqsysdspqwisrsvsnveaqlkkgfeqikvkiggtsfkedvrhinalq htagssitmildanqsydaaaafkweryfsewtnigwleeplpfdqpqdyamlrsrlsvp vaggenmkgpaqyvpllsqrcldiiqpdvmhvngidefrdclqlaryfgvrasahaydgs lsrlyalfaqaclppwskmkndhiepiewdvmenpftdlvslqpskgmvhipkgkgigte inmeivnrykwdgsay
Timeline for d2gdqb1:
View in 3D Domains from other chains: (mouse over for more information) d2gdqa1, d2gdqa2, d2gdqa3, d2gdqa4 |