Lineage for d2gdqa1 (2gdq A:119-374)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445529Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2445587Protein Hypothetical protein YitF [141844] (1 species)
  7. 2445588Species Bacillus subtilis [TaxId:1423] [141845] (2 PDB entries)
    Uniprot O06741 115-371
  8. 2445589Domain d2gdqa1: 2gdq A:119-374 [135020]
    Other proteins in same PDB: d2gdqa2, d2gdqa3, d2gdqa4, d2gdqb2, d2gdqb3, d2gdqb4

Details for d2gdqa1

PDB Entry: 2gdq (more details), 1.8 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from bacillus subtilis at 1.8 a resolution
PDB Compounds: (A:) yitF

SCOPe Domain Sequences for d2gdqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdqa1 c.1.11.2 (A:119-374) Hypothetical protein YitF {Bacillus subtilis [TaxId: 1423]}
ryreeipvyasfqsysdspqwisrsvsnveaqlkkgfeqikvkiggtsfkedvrhinalq
htagssitmildanqsydaaaafkweryfsewtnigwleeplpfdqpqdyamlrsrlsvp
vaggenmkgpaqyvpllsqrcldiiqpdvmhvngidefrdclqlaryfgvrasahaydgs
lsrlyalfaqaclppwskmkndhiepiewdvmenpftdlvslqpskgmvhipkgkgigte
inmeivnrykwdgsay

SCOPe Domain Coordinates for d2gdqa1:

Click to download the PDB-style file with coordinates for d2gdqa1.
(The format of our PDB-style files is described here.)

Timeline for d2gdqa1: