| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (6 families) ![]() |
| Family d.80.1.3: MIF-related [55339] (2 proteins) |
| Protein Microphage migration inhibition factor (MIF) [55340] (5 species) synonym: glycosylation-inhibiting factor (GIF) |
| Species Mouse (Mus musculus) [TaxId:10090] [55343] (3 PDB entries) |
| Domain d2gdgb1: 2gdg B:1-114 [135016] automatically matched to d1mfia_ |
PDB Entry: 2gdg (more details), 1.45 Å
SCOP Domain Sequences for d2gdgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdgb1 d.80.1.3 (B:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]}
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa
Timeline for d2gdgb1: