Lineage for d2gdgb1 (2gdg B:1-114)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727709Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 727710Superfamily d.80.1: Tautomerase/MIF [55331] (6 families) (S)
  5. 727795Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 727801Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 727841Species Mouse (Mus musculus) [TaxId:10090] [55343] (3 PDB entries)
  8. 727843Domain d2gdgb1: 2gdg B:1-114 [135016]
    automatically matched to d1mfia_

Details for d2gdgb1

PDB Entry: 2gdg (more details), 1.45 Å

PDB Description: Crystal structure of covalently modified macrophage inhibitory factor
PDB Compounds: (B:) macrophage migration inhibitory factor

SCOP Domain Sequences for d2gdgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdgb1 d.80.1.3 (B:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]}
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa

SCOP Domain Coordinates for d2gdgb1:

Click to download the PDB-style file with coordinates for d2gdgb1.
(The format of our PDB-style files is described here.)

Timeline for d2gdgb1: