Lineage for d2gdgb_ (2gdg B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2526467Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2526468Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2526662Family d.80.1.3: MIF-related [55339] (2 proteins)
    automatically mapped to Pfam PF01187
  6. 2526679Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2526930Species Mouse (Mus musculus) [TaxId:10090] [55343] (3 PDB entries)
  8. 2526932Domain d2gdgb_: 2gdg B: [135016]
    automated match to d1mfia_

Details for d2gdgb_

PDB Entry: 2gdg (more details), 1.45 Å

PDB Description: Crystal structure of covalently modified macrophage inhibitory factor
PDB Compounds: (B:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d2gdgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdgb_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]}
pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs
lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa

SCOPe Domain Coordinates for d2gdgb_:

Click to download the PDB-style file with coordinates for d2gdgb_.
(The format of our PDB-style files is described here.)

Timeline for d2gdgb_: