Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
Protein Microphage migration inhibition factor (MIF) [55340] (7 species) synonym: glycosylation-inhibiting factor (GIF) |
Species Mouse (Mus musculus) [TaxId:10090] [55343] (3 PDB entries) |
Domain d2gdga_: 2gdg A: [135015] automated match to d1mfia_ |
PDB Entry: 2gdg (more details), 1.45 Å
SCOPe Domain Sequences for d2gdga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdga_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} pmfivntnvprasvpegflseltqqlaqatgkpaqyiavhvvpdqlmtfsgtndpcalcs lhsigkiggaqnrnyskllcgllsdrlhispdrvyinyydmnaanvgwngstfa
Timeline for d2gdga_: