SCOPe 2.02: Domain d2gddd_: 2gdd D:

Lineage for d2gddd_ (2gdd D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (13 PDB entries)

8. Domain d2gddd_: 2gdd D: [135014]
   automated match to d1a0la_
   complexed with 5am

Details for d2gddd_

PDB Entry: 2gdd, 2.35 Å

PDB Description: human beta ii tryptase with inhibitor cra-27592

PDB Compounds: (D:) Tryptase beta-2

SCOPe Domain Sequences for d2gddd_:

Sequence; same for both SEQRES and ATOM records:

>d2gddd_ b.47.1.2 (D:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d2gddd_:

• d2gddd_ first appeared in SCOP 1.73, called d2gddd1
  
• d2gddd_ appears in SCOPe 2.01
  
• d2gddd_ appears in SCOPe 2.03
  
• d2gddd_ appears in the current release, SCOPe 2.08