![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein beta-Tryptase [50546] (1 species) ring-like tetramer with active sites facing a central pore |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50547] (22 PDB entries) |
![]() | Domain d2gddb_: 2gdd B: [135012] automated match to d1a0la_ complexed with 5am |
PDB Entry: 2gdd (more details), 2.35 Å
SCOPe Domain Sequences for d2gddb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gddb_ b.47.1.2 (B:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy vpk
Timeline for d2gddb_: