Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein beta-Tryptase [50546] (1 species) ring-like tetramer with active sites facing a central pore |
Species Human (Homo sapiens) [TaxId:9606] [50547] (18 PDB entries) |
Domain d2gdda_: 2gdd A: [135011] automated match to d1a0la_ complexed with 5am |
PDB Entry: 2gdd (more details), 2.35 Å
SCOPe Domain Sequences for d2gdda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdda_ b.47.1.2 (A:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy vpk
Timeline for d2gdda_: