SCOPe 2.02: Domain d2gcya1: 2gcy A:2-111

Lineage for d2gcya1 (2gcy A:2-111)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)

8. Domain d2gcya1: 2gcy A:2-111 [134994]
   Other proteins in same PDB: d2gcya2
   automatically matched to d1egjl1
   complexed with so4

Details for d2gcya1

PDB Entry: 2gcy, 2.5 Å

PDB Description: humanized antibody C25 Fab fragment

PDB Compounds: (A:) huC25 fab fragment light chain

SCOPe Domain Sequences for d2gcya1:

Sequence; same for both SEQRES and ATOM records:

>d2gcya1 b.1.1.1 (A:2-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
ivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlepg
iparfsgsgsgtdftltisslepedfavyycqqsneapftfgqgtkveik

Timeline for d2gcya1:

• d2gcya1 first appeared in SCOP 1.73
  
• d2gcya1 appears in SCOPe 2.01
  
• d2gcya1 appears in SCOPe 2.03
  
• d2gcya1 appears in the current release, SCOPe 2.08