SCOPe 2.08: Domain d2gcya1: 2gcy A:1-110

Lineage for d2gcya1 (2gcy A:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d2gcya1: 2gcy A:1-110 [134994]
   Other proteins in same PDB: d2gcya2, d2gcyb1, d2gcyb2
   automated match to d4fnll1
   complexed with so4

Details for d2gcya1

PDB Entry: 2gcy, 2.5 Å

PDB Description: humanized antibody C25 Fab fragment

PDB Compounds: (A:) huC25 fab fragment light chain

SCOPe Domain Sequences for d2gcya1:

Sequence; same for both SEQRES and ATOM records:

>d2gcya1 b.1.1.0 (A:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlep
giparfsgsgsgtdftltisslepedfavyycqqsneapftfgqgtkvei

Timeline for d2gcya1:

• d2gcya1 first appeared in SCOP 1.73
  
• d2gcya1 appears in SCOPe 2.07